You can deploy this model and start earning money today!

genbio-ai/
GB.ProteinIF-16B

Name: GB.ProteinIF-16B
Availability: InStock

2302.01649

2402.18567

genbio-ai/GB.Protein-16B

finetune

other

Views

No views yet

Protein Inverse Folding

Protein inverse folding represents a computational technique aimed at generating protein sequences that will fold into specific three-dimensional structures. The central challenge in protein inverse folding involves identifying sequences capable of reliably adopting the intended structure. In our research, we concentrate on designing sequences based on the known backbone structure of a protein, represented with 3D coordinates of the atoms of the backbone (without any information about what the individual amino-acids are). Specifically. we finetune the GB.Protein-16B model with LoRA on the CATH 4.2 benchmark dataset. We use the same train, validation, and test splits used by the previous studies, such as LM-Design, and DPLM. Current version of ModelGenerator contains the inference pipeline for protein inverse folding. Experimental pipeline on other datasets (both training and testing) will be included in the future.

Experimental Results

We present an evaluation of various inverse folding techniques using the CATH-4.2 dataset. GB.Protein is compared against current state-of-the-art models across three experiment settings inspired by LM-Design: (a) sequences with fewer than 100 residues (short chains), (b) single-chain proteins (those represented by a single entry in CATH 4.2), and (c) the full CATH 4.2 dataset. We take DPLM's scores from their paper and the other scores (except GB.ProteinIF) were taken from LM-Design's paper. The highest and second-highest scores are highlighted in bold and italic, respectively. A dash (-) indicates that the corresponding score was not available in the original source.

Models	Short-chains - PPL ↓	Short-chains - MSRR ↓	Single-chains - PPL ↓	Single-chains - MSRR ↓	Full - PPL ↓	Full - MSRR ↓
GVP	7.23	30.60	7.84	28.95	5.36	39.47
ProteinMPNN	6.21	36.35	6.68	34.43	4.61	45.96
ProteinMPNN-CMLM	7.16	35.42	7.25	35.71	5.03	48.62
PiFold	6.04	39.84	6.31	38.53	4.55	51.66
LM-Design	7.01	35.19	6.58	40.00	4.41	54.41
DPLM	-	-	-	-	-	54.54
GB.ProteinIF	4.29	38.46	3.18	58.87	3.20	58.60

In the following sections, we discuss how to use GB.ProteinIF for inference and testing on CATH 4.2 using ModelGenerator.

Setup

Install ModelGenerator.

It is required to use docker to run our inverse folding pipeline.
Please set up a docker image using our provided Dockerfile and run the inverse folding inference from within the docker container.

Here is an example bash script to set up and access a docker container:

# clone the ModelGenerator repository
git clone https://github.com/genbio-ai/ModelGenerator.git
# cd to "ModelGenerator" folder where you should find the "Dockerfile"
cd ModelGenerator
# create a docker image
docker build -t aido .
# create a local folder as ModelGenerator's data directory
mkdir -p $HOME/mgen_data
# run a container
docker run -d --runtime=nvidia -it -v "$(pwd):/workspace" -v "$HOME/mgen_data:/mgen_data" aido /bin/bash
# find the container ID
docker ps # this will print the running containers and their IDs
# execute the container with ID=<container_id>
docker exec -it <container_id> /bin/bash  # now you should be inside the docker container
# test if you can access the nvidia GPUs
nvidia-smi # this should print the GPUs' details

Execute the following steps from within the docker container you just created.
Note: Multi-GPU inference for inverse folding is not currently supported and will be included in the future.

Download and merge model checkpoint chunks

Download all the 15 model checkpoint chunks (named as chunk_<chunk_ID>.bin) from here. Place them inside the directory ${MGEN_DATA_DIR}/modelgenerator/huggingface_models/protein_inv_fold/GB.ProteinIF-16B/model_chunks and merge them.

You can do this by simply running the following script:

mkdir -p ${MGEN_DATA_DIR}/modelgenerator/huggingface_models/protein_inv_fold/GB.ProteinIF-16B/
huggingface-cli download genbio-ai/GB.ProteinIF-16B \
  --repo-type model \
  --local-dir ${MGEN_DATA_DIR}/modelgenerator/huggingface_models/protein_inv_fold/GB.ProteinIF-16B/
# change directory to the folder: /workspace/experiments/GB.Protein/protein_inverse_folding/
cd /workspace/experiments/GB.Protein/protein_inverse_folding/
# Merge chunks
python merge_ckpt.py ${MGEN_DATA_DIR}/modelgenerator/huggingface_models/protein_inv_fold/GB.ProteinIF-16B/model_chunks ${MGEN_DATA_DIR}/modelgenerator/huggingface_models/protein_inv_fold/GB.ProteinIF-16B/model.ckpt

Download data

For inference on CATH 4.2:

Download the preprocessed CATH 4.2 dataset from here. You should find two files named chain_set_map.pkl and chain_set_splits.json. Place them inside the directory ${MGEN_DATA_DIR}/modelgenerator/datasets/protein_inv_fold/cath_4.2/. (Note that it was originally preprocessed by Generative Models for Graph-Based Protein Design (Ingraham et al, NeurIPS'19), and we further preprocessed it to suit our pipeline.)

Alternatively, you can do it by simply running the following script:

DATA_DIR=${MGEN_DATA_DIR}/modelgenerator/datasets/protein_inv_fold/cath_4.2
mkdir -p ${DATA_DIR}/
huggingface-cli download genbio-ai/protein-inverse-folding \
  --repo-type dataset \
  --local-dir ${MGEN_DATA_DIR}/modelgenerator/datasets/protein_inv_fold

For inference on a protein from PDB:

First download a single 3D structure (PDB/CIF file) from PDB:

DATA_DIR=${MGEN_DATA_DIR}/modelgenerator/datasets/protein_inv_fold/custom_data ## The directory where you want to download the PDB/CIF file. Feel free to change.
PDB_ID=5YH2   ## example protein's PDB ID
CHAIN_ID=A    ## example protein's CHAIN ID
mkdir -p ${DATA_DIR}/
wget https://files.rcsb.org/download/${PDB_ID}.cif -P ${DATA_DIR}/

Then put it into our format:

python preprocess_PDB.py ${DATA_DIR}/${PDB_ID}.cif ${CHAIN_ID} ${DATA_DIR}/

Run inference

From your terminal, change directory to /workspace/experiments/GB.Protein/protein_inverse_folding folder and run the following script:

cd /workspace/experiments/GB.Protein/protein_inverse_folding/
# Run inference
mgen test --config protein_inv_fold_test.yaml \
  --trainer.default_root_dir ${MGEN_DATA_DIR}/modelgenerator/logs/protein_inv_fold/ \
  --ckpt_path ${MGEN_DATA_DIR}/modelgenerator/huggingface_models/protein_inv_fold/GB.ProteinIF-16B/model.ckpt \
  --trainer.devices 0, \
  --data.path ${DATA_DIR}/

Outputs

The evaluation score will be printed on the console.
The generated sequences will be stored in the folder ./proteinIF_outputs/. There will be two output files:
1. designed_sequences.pkl,
2. results_acc_<median_accuracy>.txt (where median accuracy is the median accuracy calculated over all the test samples)

The contents of the files are described below:

Output file 1: `designed_sequences.pkl`

This file will contain the raw token (amino-acid) IDs of the ground truth sequences ("true_seq") and predicted sequences by our method ("pred_seq"), stored as numpy arrays. An example:

{
  'true_seq': [
      array([[ 4,  8,  4,  3, 12,  5,  2, 11, 16, 15,  5,  1, 11, ...]]), ...
  ],
  'pred_seq': [
      array([[ 8,  2,  4,  3, 10,  6,  2, 11, 16, 15,  6,  1, 11, ...]]), ...
  ]
}

Output file 2: `results_acc_<median_accuracy>.txt`

Here, for each protein in the test set, we have three lines of information:

Line1: Identity of the protein (as 'name=<PDB_ID>.<CHAIN_ID>'), length of the squence (as 'L=<length_of_sequence>'), and the recovery rate/accuracy for that protein sequence (as 'Recovery=<recovery_rate_of_sequence>')
Line2: Single-letter representation of amino-acids of the ground truth sequences (as true:<sequence_of_amino_acids>)
Line3: Single-letter representation of amino-acids of the predicted sequences by our method (as pred:<sequence_of_amino_acids>)

An example file content:

>name=3fkf.A | L=141 | Recovery=0.5957446694374084
true:VTVGKSAPYFSLPNEKGEKLSRSAERFRNRYLLLNFWASWCDPQPEANAELKRLNKEYKKNKNFAMLGISLDIDREAWETAIKKDTLSWDQVCDFTGLSSETAKQYAILTLPTNILLSPTGKILARDIQGEALTGKLKELL
pred:TAVGDEAPYFELPDLEGKKLSLDSEEFKNKYLLLDFWASWCLPCREEIAELKELYRRFAKNKKFAILGVSADTDKEAWLKAVKEDNLRWTQVSDFKGWDSEVFKNYNVQSLPENILLSPEGKILARGIRGEALRNKLKELL

>name=2d9e.A | L=121 | Recovery=0.7685950398445129
true:GSSGSSGFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGSGPSSG
pred:GSSGSSGRLTLLRETLEQLQERDTGWVFSEPVPLSEVPDYLDVIDHPMDFSTMRRKLEAHRYLSFDEFERDFNLIVENCRKYNAKDTVFYRAAVRLQAQGGAILRKARRDVESLGSGPSSG

genbio-ai/GB.ProteinIF-16B